Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334039.1 | complete | 194 | 71-655(+) |
Amino Acid sequence : | |||
MVKNYPAVSEEYLKAVEKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRP DKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLXRCHKERSGFEGPWTTNPLIFDTPTSRSF* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 11,341.114 | ||
Theoretical pI: | 9.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 43.311 | ||
aromaticity | 0.059 | ||
GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.257 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334039.1 | 5prime_partial | 102 | 837-529(-) |
Amino Acid sequence : | |||
ITIVSSGIGESQLRELQVSLGVICEESILIRGIFLNERAEGRVRKKSLVCWQLQKTLFLSTQKLLEVGVSKMRGFVVHGPSNPDRSLWHLXRVWPPESATIS* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,341.114 | ||
Theoretical pI: | 9.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 43.311 | ||
aromaticity | 0.059 | ||
GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.257 | ||
sheet | 0.238 |