| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| QREHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDSSTNEKGLLLNFEDRNGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGLGDVAKDRLFIDWRRRPDAPDLPPPP HHFSFHRSLHHPWSPLFMPPPPPPPRDYSNLLHYHHHPPTGYGPYSYGSVVNGNPCPPGSIVYLRSASAAGSGGVPVGGQRAVEQMVFESVPVVQGKAAAKRLRLFGVNMECPISESDEC DAGGATAAPSLRR | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | 5prime_partial | 240 | 2-724(+) |
Amino Acid sequence : | |||
| PEGAHVRQSGDSERRREAESAGDSEAARREILSAGFIHQREGAAAEFRGPQREAVAVPLLLLEQQPELRDDQRLEPIREGEEARRRRHRLLPARPRRRRQGPPLHRLAPPPRRPRPSPAA PPLLLPPLPPPPLEPALHAASASSAAGLFQSSSLPPPPAHGLRPLFLRECGEWKPLPSRVHCILKISFGRRQRWSSSGGTKSGGADGVRVGAGGARESCGEETEAVWSEHGVSNFRIGRM * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | complete | 117 | 461-108(-) |
Amino Acid sequence : | |||
| MKKIGIVPRRRRRRRHEERAPGVVEGAVEGEVVGRRGKVGGVGAAAPVDEEAVLGDVAEAALEGDDVAGVELLLLHESAPTFGHHVALAAVPVGVTEPPRLPVAVLEIQQQPLLVGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | 5prime_partial | 116 | 762-412(-) |
Amino Acid sequence : | |||
| PVAATAPPLHRRHHIRPIRKLDTPCSLQTASVSSPQLSLAPPAPTRTPSAPPLFVPPLELHRCLRPKLILSIQWTLEGKGFHSPHSRRNKGRSPWAGGGGNEEDWNSPAAEEAEAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| QREHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDSSTNEKGLLLNFEDRNGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGLGDVAKDRLFIDWRRRPDAPDLPPPP HHFSFHRSLHHPWSPLFMPPPPPPPRDYSNLLHYHHHPPTGYGPYSYGSVVNGNPCPPGSIVYLRSASAAGSGGVPVGGQRAVEQMVFESVPVVQGKAAAKRLRLFGVNMECPISESDEC DAGGATAAPSLRR | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | 5prime_partial | 240 | 2-724(+) |
Amino Acid sequence : | |||
| PEGAHVRQSGDSERRREAESAGDSEAARREILSAGFIHQREGAAAEFRGPQREAVAVPLLLLEQQPELRDDQRLEPIREGEEARRRRHRLLPARPRRRRQGPPLHRLAPPPRRPRPSPAA PPLLLPPLPPPPLEPALHAASASSAAGLFQSSSLPPPPAHGLRPLFLRECGEWKPLPSRVHCILKISFGRRQRWSSSGGTKSGGADGVRVGAGGARESCGEETEAVWSEHGVSNFRIGRM * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | complete | 117 | 461-108(-) |
Amino Acid sequence : | |||
| MKKIGIVPRRRRRRRHEERAPGVVEGAVEGEVVGRRGKVGGVGAAAPVDEEAVLGDVAEAALEGDDVAGVELLLLHESAPTFGHHVALAAVPVGVTEPPRLPVAVLEIQQQPLLVGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334047.1 | 5prime_partial | 116 | 762-412(-) |
Amino Acid sequence : | |||
| PVAATAPPLHRRHHIRPIRKLDTPCSLQTASVSSPQLSLAPPAPTRTPSAPPLFVPPLELHRCLRPKLILSIQWTLEGKGFHSPHSRRNKGRSPWAGGGGNEEDWNSPAAEEAEAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,579.162 | ||
| Theoretical pI: | 10.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 87.320 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.207 | ||
| turn | 0.336 | ||
| sheet | 0.276 | ||