| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334049.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
| ADVAAVSAGNNYEVGNMIAEALSKVGRKGVVTLEEGRSAENHLYVVEGMQFDRGYISPYFVTDSEKMAVEFENCKLLLVDKKITNARDLINVLEDAIRGAYPVLIIAEDIETEALGT | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,768.327 | ||
| Theoretical pI: | 4.503 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 22.066 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.197 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334049.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
| ADVAAVSAGNNYEVGNMIAEALSKVGRKGVVTLEEGRSAENHLYVVEGMQFDRGYISPYFVTDSEKMAVEFENCKLLLVDKKITNARDLINVLEDAIRGAYPVLIIAEDIETEALGT | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,768.327 | ||
| Theoretical pI: | 4.503 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 22.066 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.197 | ||
| sheet | 0.333 | ||