Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334065.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
KIDFREGPALPVLDQMVADGKYEGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRII* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,162.014 | ||
Theoretical pI: | 5.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 37.046 | ||
aromaticity | 0.112 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.388 | ||
turn | 0.198 | ||
sheet | 0.224 |