| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334065.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
| KIDFREGPALPVLDQMVADGKYEGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRII* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,162.014 | ||
| Theoretical pI: | 5.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 37.046 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.198 | ||
| sheet | 0.224 | ||