| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334067.1 | 5prime_partial | 249 | 2-751(+) |
Amino Acid sequence : | |||
| RFTTAAATATSTMGEIAADSAMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRESELIEENALGVR NAAQRKLLDELGIPAEDVPVDQFTPLGRMLYKAPSDGIWGEHELDYLLFIVRDVEVHPNPDEVADVKYVNREELKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKGTLNEAVDM KTIHRLLEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 28,676.331 | ||
| Theoretical pI: | 5.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 27.616 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.165 | ||
| sheet | 0.329 | ||