| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334071.1 | 5prime_partial | 193 | 3-584(+) |
Amino Acid sequence : | |||
| KDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKLSDKPVVVCHQQEYEY AVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 20,092.344 | ||
| Theoretical pI: | 9.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 70.280 | ||
| aromaticity | 0.055 | ||
| GRAVY | -1.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.155 | ||
| turn | 0.359 | ||
| sheet | 0.144 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334071.1 | complete | 181 | 735-190(-) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,092.344 | ||
| Theoretical pI: | 9.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 70.280 | ||
| aromaticity | 0.055 | ||
| GRAVY | -1.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.155 | ||
| turn | 0.359 | ||
| sheet | 0.144 | ||