Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334071.1 | 5prime_partial | 193 | 3-584(+) |
Amino Acid sequence : | |||
KDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKLSDKPVVVCHQQEYEY AVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 20,092.344 | ||
Theoretical pI: | 9.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 70.280 | ||
aromaticity | 0.055 | ||
GRAVY | -1.070 | ||
Secondary Structure Fraction | |||
Helix | 0.155 | ||
turn | 0.359 | ||
sheet | 0.144 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334071.1 | complete | 181 | 735-190(-) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,092.344 | ||
Theoretical pI: | 9.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 70.280 | ||
aromaticity | 0.055 | ||
GRAVY | -1.070 | ||
Secondary Structure Fraction | |||
Helix | 0.155 | ||
turn | 0.359 | ||
sheet | 0.144 |