| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334079.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
| ISFITFPLLFFLLLLLWKYLQKPKKNFPPSPQKLPIIGNLHQLSPLPHQDFDSMARKHGPLMLLHFGKVPVLVVSSADAACAIMKAHDLTFSSRPQYKTFKKLFYNCREVAFSPYSEYSR QMKSVFVLHLLSAKRVQSFRSIREEETALFVKRVEESIGPVNLSDMFGEFTNDVICRSAFGEKFRESEKGKKLVWLLREIIALLGMISLGDFIPWLGWIDRVNGLDKRLDRVAREMDDFL NDVIDERVEVTKGGNLSENFVDIMLEIYSEKKDGASL | |||
Physicochemical properties | |||
| Number of amino acids: | 277 | ||
| Molecular weight: | 31,881.846 | ||
| Theoretical pI: | 8.841 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 43.348 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.217 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334079.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
| ISFITFPLLFFLLLLLWKYLQKPKKNFPPSPQKLPIIGNLHQLSPLPHQDFDSMARKHGPLMLLHFGKVPVLVVSSADAACAIMKAHDLTFSSRPQYKTFKKLFYNCREVAFSPYSEYSR QMKSVFVLHLLSAKRVQSFRSIREEETALFVKRVEESIGPVNLSDMFGEFTNDVICRSAFGEKFRESEKGKKLVWLLREIIALLGMISLGDFIPWLGWIDRVNGLDKRLDRVAREMDDFL NDVIDERVEVTKGGNLSENFVDIMLEIYSEKKDGASL | |||
Physicochemical properties | |||
| Number of amino acids: | 277 | ||
| Molecular weight: | 31,881.846 | ||
| Theoretical pI: | 8.841 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 43.348 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.217 | ||
| sheet | 0.271 | ||