Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334088.1	complete	210	66-698(+)
Amino Acid sequence :
MEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAF IINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSRLLSQAVDQAKELMDQFQLVHIVASLTLAXRYTRV*
Physicochemical properties
Number of amino acids:		210
Molecular weight:		23,245.058
Theoretical pI:		5.412
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 19940
Instability index:		38.484
aromaticity		0.086
GRAVY		-0.209
Secondary Structure Fraction
Helix		0.321
turn		0.225
sheet		0.273