Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
FSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPAN FAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGIAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAAD PFEYCDLVNTTTHKSLRGSRAGMIFY | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
SSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPL ISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | complete | 134 | 686-282(-) |
Amino Acid sequence : | |||
MRHIAEQKRPALISNLPKSLVIPVPRISNPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
LLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
FSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPAN FAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGIAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAAD PFEYCDLVNTTTHKSLRGSRAGMIFY | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
SSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPL ISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | complete | 134 | 686-282(-) |
Amino Acid sequence : | |||
MRHIAEQKRPALISNLPKSLVIPVPRISNPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334091.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
LLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 14,463.731 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 100.326 | ||
aromaticity | 0.017 | ||
GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.235 | ||
sheet | 0.235 |