| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
| FSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPAN FAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGIAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAAD PFEYCDLVNTTTHKSLRGSRAGMIFY | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
| SSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPL ISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | complete | 134 | 686-282(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISNPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
| LLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
| FSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPAN FAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGIAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAAD PFEYCDLVNTTTHKSLRGSRAGMIFY | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
| SSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPL ISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | complete | 134 | 686-282(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISNPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334091.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
| LLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 14,463.731 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 100.326 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||