| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334092.1 | 5prime_partial | 204 | 771-157(-) |
Amino Acid sequence : | |||
| ILLSYSVDVVIADVKKFLSETQSEIIILEIRTEFGHDDPPEFAEFLTSQLGEYLIHQDDAVFNKPVAELLPKRVICVWKPRKAAAPKRGDPLWSSGYLKDNWIDTDKPSTKFESNMQHLG EQTPAAERKYFYRVENTVTPQADNPIVCVRPVTGRIQPYARTFISQCLARGIADRLQIFSTDFIDGDFVDACAGLTCARVEGKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 16,059.723 | ||
| Theoretical pI: | 11.744 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.996 | ||
| aromaticity | 0.035 | ||
| GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.239 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334092.1 | complete | 158 | 136-612(+) |
Amino Acid sequence : | |||
| MQKKNDWSGFTLNPSAGQSGAGIHKISVDKIRRKYLQSIRDSPRQTLRYERPRVRLDPPRHRPNAHYRIIRLRRHRVLHPVKILPLRRRRLLPQMLHIALEFRRRLVGVDPVVLQVPGAP QRISALRRRRLPRLPHADHAFREQLRHGFVENGVVLVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 16,059.723 | ||
| Theoretical pI: | 11.744 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.996 | ||
| aromaticity | 0.035 | ||
| GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.239 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334092.1 | 5prime_partial | 142 | 769-341(-) |
Amino Acid sequence : | |||
| PPQLLRRRRHRRRQKVPQRNTIRDHHPRNPYRVRPRRPARVRRVPHESTRRIPNPPGRRRFQQTRGGAAPETRDLRVEAAEGGGAEARRSAVELRVLEGQLDRHRQAVDEIREQYAAFGG ADAGGGAEVFLQGGEHGDAAGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,059.723 | ||
| Theoretical pI: | 11.744 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.996 | ||
| aromaticity | 0.035 | ||
| GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.239 | ||
| sheet | 0.239 | ||