Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334092.1 | 5prime_partial | 204 | 771-157(-) |
Amino Acid sequence : | |||
ILLSYSVDVVIADVKKFLSETQSEIIILEIRTEFGHDDPPEFAEFLTSQLGEYLIHQDDAVFNKPVAELLPKRVICVWKPRKAAAPKRGDPLWSSGYLKDNWIDTDKPSTKFESNMQHLG EQTPAAERKYFYRVENTVTPQADNPIVCVRPVTGRIQPYARTFISQCLARGIADRLQIFSTDFIDGDFVDACAGLTCARVEGKA* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 16,059.723 | ||
Theoretical pI: | 11.744 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 87.996 | ||
aromaticity | 0.035 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.239 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334092.1 | complete | 158 | 136-612(+) |
Amino Acid sequence : | |||
MQKKNDWSGFTLNPSAGQSGAGIHKISVDKIRRKYLQSIRDSPRQTLRYERPRVRLDPPRHRPNAHYRIIRLRRHRVLHPVKILPLRRRRLLPQMLHIALEFRRRLVGVDPVVLQVPGAP QRISALRRRRLPRLPHADHAFREQLRHGFVENGVVLVD* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 16,059.723 | ||
Theoretical pI: | 11.744 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 87.996 | ||
aromaticity | 0.035 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.239 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334092.1 | 5prime_partial | 142 | 769-341(-) |
Amino Acid sequence : | |||
PPQLLRRRRHRRRQKVPQRNTIRDHHPRNPYRVRPRRPARVRRVPHESTRRIPNPPGRRRFQQTRGGAAPETRDLRVEAAEGGGAEARRSAVELRVLEGQLDRHRQAVDEIREQYAAFGG ADAGGGAEVFLQGGEHGDAAGG* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 16,059.723 | ||
Theoretical pI: | 11.744 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 87.996 | ||
aromaticity | 0.035 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.239 | ||
sheet | 0.239 |