Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
AKSPPPPPPKMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIF TGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDSLFVKLKALNGERSRLAQSFEYNYGDFIPI LRPFL | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | internal | 245 | 735-1(-) |
Amino Acid sequence : | |||
QKRPQNRDEITIVVLEALRQSTPLPIQRLQFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHV LPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEEKIHFRWWW WWRFR | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
RNLHHHHHRKWIFSSSRRRFSASSSPSSSPPWSRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAMLCSIFS PGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
EISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
AKSPPPPPPKMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIF TGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDSLFVKLKALNGERSRLAQSFEYNYGDFIPI LRPFL | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | internal | 245 | 735-1(-) |
Amino Acid sequence : | |||
QKRPQNRDEITIVVLEALRQSTPLPIQRLQFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHV LPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEEKIHFRWWW WWRFR | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
RNLHHHHHRKWIFSSSRRRFSASSSPSSSPPWSRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAMLCSIFS PGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334093.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
EISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,689.800 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.125 | ||
aromaticity | 0.029 | ||
GRAVY | -1.365 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.305 | ||
sheet | 0.257 |