| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334094.1 | complete | 246 | 763-23(-) |
Amino Acid sequence : | |||
| MAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKLTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLH CVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPPKEAIRANLCKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFRKVMYTW LIFGST* | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 25,999.019 | ||
| Theoretical pI: | 8.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 36.117 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334094.1 | complete | 246 | 763-23(-) |
Amino Acid sequence : | |||
| MAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKLTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLH CVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPPKEAIRANLCKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFRKVMYTW LIFGST* | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 25,999.019 | ||
| Theoretical pI: | 8.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 36.117 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||