| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334098.1 | internal | 282 | 2-847(+) |
Amino Acid sequence : | |||
| FGIHLQQAFDTALYRFNIPNLRVGTLDSLLALSDDLLKSNNFIEGVSQKIRRQIEELERLSGVVSSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKEIVDGIHTQIAKIEDDMKVRAAEY NNVRSQLNTINRKQAGSLAVRDLSDLVKPQDIITSEHLTTLLVIVSKYSQKDWLSSYETLTTYVVPRSSKKLHEDNEYALYTVTLFSRDADNFRIKARERNFQVRDFEYNTETQDSRKQE LERLVQEQETMRSALLQWCYTSYGEVFSSWMHFCAVRVFSES | |||
Physicochemical properties | |||
| Number of amino acids: | 282 | ||
| Molecular weight: | 32,663.413 | ||
| Theoretical pI: | 5.517 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39880 40005 | ||
| Instability index: | 46.173 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.191 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334098.1 | internal | 282 | 2-847(+) |
Amino Acid sequence : | |||
| FGIHLQQAFDTALYRFNIPNLRVGTLDSLLALSDDLLKSNNFIEGVSQKIRRQIEELERLSGVVSSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKEIVDGIHTQIAKIEDDMKVRAAEY NNVRSQLNTINRKQAGSLAVRDLSDLVKPQDIITSEHLTTLLVIVSKYSQKDWLSSYETLTTYVVPRSSKKLHEDNEYALYTVTLFSRDADNFRIKARERNFQVRDFEYNTETQDSRKQE LERLVQEQETMRSALLQWCYTSYGEVFSSWMHFCAVRVFSES | |||
Physicochemical properties | |||
| Number of amino acids: | 282 | ||
| Molecular weight: | 32,663.413 | ||
| Theoretical pI: | 5.517 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39880 40005 | ||
| Instability index: | 46.173 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.191 | ||
| sheet | 0.245 | ||