| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334103.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| GLDTSVNGPGVKHVLKSSLDDDKNDYYALGTYDPIKNKWIPDYPEIDVGIGLRYDYGKYYASKTFYDQNRKRRILWGWISETDAEAVDLLKGWSGLQTIPRTITFDKKMGNDILQWPIEE VESLRTSGIEFDDIELPPGSIVPLTVDLGSQLDVVATFEIDEEALEAVVEADINYNCTTSGGAANRGVLGPFGVVVLAEETLSELTPIYFYIIKGSNGQIQTHFCADELRSSKALDVDKI VYGKQVPVLDGEKLS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,295.438 | ||
| Theoretical pI: | 4.445 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46995 | ||
| Instability index: | 44.435 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.235 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334103.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| GLDTSVNGPGVKHVLKSSLDDDKNDYYALGTYDPIKNKWIPDYPEIDVGIGLRYDYGKYYASKTFYDQNRKRRILWGWISETDAEAVDLLKGWSGLQTIPRTITFDKKMGNDILQWPIEE VESLRTSGIEFDDIELPPGSIVPLTVDLGSQLDVVATFEIDEEALEAVVEADINYNCTTSGGAANRGVLGPFGVVVLAEETLSELTPIYFYIIKGSNGQIQTHFCADELRSSKALDVDKI VYGKQVPVLDGEKLS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,295.438 | ||
| Theoretical pI: | 4.445 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46995 | ||
| Instability index: | 44.435 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.235 | ||
| sheet | 0.220 | ||