Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334106.1 | 5prime_partial | 250 | 815-63(-) |
Amino Acid sequence : | |||
GFKPERPIDLTQTLNELRIPDCVPNITEDPVSVRRVDPVGDSWVYATTCKMETFSFNVSPAKLSHLRSKLAKHGVDSPSFESLAAAIWQCIARIRADSRVVNIFRKGHEASSNNSILGNN QIVSVVRAAFAVAEANPSELAWMLKNEALDETKIIQQAVERDGGSSDFIIFGVNLSFVNLEEATFYDLECRRGQKPISVSCKIDSVGEKGVVLVLPGDGDKSGGRLVTVTLPENEVVGVK SELKREGLMA* | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,285.751 | ||
Theoretical pI: | 5.552 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 45.536 | ||
aromaticity | 0.060 | ||
GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.260 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334106.1 | 5prime_partial | 250 | 815-63(-) |
Amino Acid sequence : | |||
GFKPERPIDLTQTLNELRIPDCVPNITEDPVSVRRVDPVGDSWVYATTCKMETFSFNVSPAKLSHLRSKLAKHGVDSPSFESLAAAIWQCIARIRADSRVVNIFRKGHEASSNNSILGNN QIVSVVRAAFAVAEANPSELAWMLKNEALDETKIIQQAVERDGGSSDFIIFGVNLSFVNLEEATFYDLECRRGQKPISVSCKIDSVGEKGVVLVLPGDGDKSGGRLVTVTLPENEVVGVK SELKREGLMA* | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,285.751 | ||
Theoretical pI: | 5.552 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 45.536 | ||
aromaticity | 0.060 | ||
GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.260 | ||
sheet | 0.244 |