Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334113.1 | complete | 174 | 791-267(-) |
Amino Acid sequence : | |||
MLRPADGNETAGSYKVAVQNRKRPSVLALSRQKLPQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSDLEIAAKAADELRKEGKAVRVVSLVSWELFDEQSDEYKESVFPAAVTARV SIEAGTTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVVAAAKALL* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 13,606.448 | ||
Theoretical pI: | 4.688 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 57.367 | ||
aromaticity | 0.093 | ||
GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.364 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334113.1 | complete | 129 | 310-699(+) |
Amino Acid sequence : | |||
MPNSLYIFPAGALAPNRSIPMAFPFEPTIFPQPNVVPASMLTLAVTAAGKTLSLYSSDCSSKSSQETRETTLTALPSFLSSSAAFAAISKSEPVPIKITSGLLPDELSEMVYPPFSTPSM EVPGSWGSF* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,606.448 | ||
Theoretical pI: | 4.688 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 57.367 | ||
aromaticity | 0.093 | ||
GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.364 | ||
sheet | 0.287 |