| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334114.1 | 5prime_partial | 178 | 2-538(+) |
Amino Acid sequence : | |||
| PNILMLRPADGNETAGSYKVAVQNRKRPSVLALSRQKLPQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSDLEIAAKAADELRKEGKAVRVVSLVSWELFDEQSDEYKESVFPAAV TARVSIEAGTTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVVAAAKALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 13,606.448 | ||
| Theoretical pI: | 4.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 57.367 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.364 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334114.1 | complete | 129 | 495-106(-) |
Amino Acid sequence : | |||
| MPNSLYIFPAGALAPNRSIPMAFPFEPTIFPQPNVVPASMLTLAVTAAGKTLSLYSSDCSSKSSQETRETTLTALPSFLSSSAAFAAISKSEPVPIKITSGLLPDELSEMVYPPFSTPSM EVPGSWGSF* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,606.448 | ||
| Theoretical pI: | 4.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 57.367 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.364 | ||
| sheet | 0.287 | ||