Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334120.1	5prime_partial	179	2-541(+)
Amino Acid sequence :
DDLLIMSDVDEIPSRHTINLLRWCDGIPPVLHLRLKNYLYSFEFLLDNNSWRASVHVYQSGKTKYAHYRQSDEILADAGWHCSFCFRHISEFIFKMKAYSHVDRVRFSHFLSPKRIQKVI CKGSDLFDMLPEEYTFKEIIGKMGPIPHSYSAVHLPAYLLEAADRYKFLLPGNCERESG*
Physicochemical properties
Number of amino acids:		179
Molecular weight:		20,961.838
Theoretical pI:		7.275
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31400 31650
Instability index:		49.512
aromaticity		0.134
GRAVY		-0.283
Secondary Structure Fraction
Helix		0.352
turn		0.212
sheet		0.235