| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334133.1 | internal | 283 | 2-850(+) |
Amino Acid sequence : | |||
| FRKPVVKLGGETLTISQVAAIAARDDGVAVELVEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQG YSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPLNADQAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFDANVLAVLSEVMSAIF AEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKA | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 16,087.689 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 98.415 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.704 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.487 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334133.1 | 5prime_partial | 182 | 850-302(-) |
Amino Acid sequence : | |||
| SLNVSAAIKNVFHYRSSLDLPWMVLQLMRQVIGEFGFPVHHFGENGGHNFRQNSKNVGVEESNRGQPGADGGAVDEGEAFLGLEFEEAAVDAGELEGLVGVEGFAGGADGFGVGAAGEEA GDVGQGDQVAGGGDGAAEGEAGGDVVVEEFGDGFQDFESDAGISLQKSVDSDEHGCSCCCVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 16,087.689 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 98.415 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.704 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.487 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334133.1 | complete | 156 | 261-731(+) |
Amino Acid sequence : | |||
| MLEYSEMGQNPTTHYHTQQQEQPCSSESTLFCRDIPASDSKSWKPSPNSSTTTSPPASPSAAPSPPPATWSPCPTSPASSPAAPTPKPSAPPANPSTPTKPSSSPASTAASSNSSPRKAS PSSTAPPSAPGWPRLLSSTPTFLLFCLKLCPPFSPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,087.689 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 98.415 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.704 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.487 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334133.1 | internal | 283 | 2-850(+) |
Amino Acid sequence : | |||
| FRKPVVKLGGETLTISQVAAIAARDDGVAVELVEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQG YSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPLNADQAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFDANVLAVLSEVMSAIF AEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKA | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 16,087.689 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 98.415 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.704 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.487 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334133.1 | 5prime_partial | 182 | 850-302(-) |
Amino Acid sequence : | |||
| SLNVSAAIKNVFHYRSSLDLPWMVLQLMRQVIGEFGFPVHHFGENGGHNFRQNSKNVGVEESNRGQPGADGGAVDEGEAFLGLEFEEAAVDAGELEGLVGVEGFAGGADGFGVGAAGEEA GDVGQGDQVAGGGDGAAEGEAGGDVVVEEFGDGFQDFESDAGISLQKSVDSDEHGCSCCCVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 16,087.689 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 98.415 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.704 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.487 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334133.1 | complete | 156 | 261-731(+) |
Amino Acid sequence : | |||
| MLEYSEMGQNPTTHYHTQQQEQPCSSESTLFCRDIPASDSKSWKPSPNSSTTTSPPASPSAAPSPPPATWSPCPTSPASSPAAPTPKPSAPPANPSTPTKPSSSPASTAASSNSSPRKAS PSSTAPPSAPGWPRLLSSTPTFLLFCLKLCPPFSPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,087.689 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 98.415 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.704 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.487 | ||
| sheet | 0.192 | ||