| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334149.1 | internal | 273 | 3-821(+) |
Amino Acid sequence : | |||
| ALVRPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQNLYKKELYDLSRWWNKFDLKTKLPYIRDRLAEAYLWGVGYHFEPQYSYVRKGVVLSIKIIGILDDTYDNYATVNEA QLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAIDWIKNEPNFA VKAGLIGRYWDDIGSPQRESKGGEMLTVMDCYM | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 32,486.010 | ||
| Theoretical pI: | 6.287 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 68300 68300 | ||
| Instability index: | 36.341 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.423 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.179 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334149.1 | internal | 273 | 3-821(+) |
Amino Acid sequence : | |||
| ALVRPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQNLYKKELYDLSRWWNKFDLKTKLPYIRDRLAEAYLWGVGYHFEPQYSYVRKGVVLSIKIIGILDDTYDNYATVNEA QLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAIDWIKNEPNFA VKAGLIGRYWDDIGSPQRESKGGEMLTVMDCYM | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 32,486.010 | ||
| Theoretical pI: | 6.287 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 68300 68300 | ||
| Instability index: | 36.341 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.423 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.179 | ||
| sheet | 0.264 | ||