Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334161.1 | 5prime_partial | 184 | 1-555(+) |
Amino Acid sequence : | |||
FEDYHGVLVEDILPNHLGILSHDTVLDYMRNFHEKSSFLRNGEEESYKKATQEMYRRHKNWTRKFNGSDAQVGPLADVFNFDNGKAFYGAANHHILRFCRHNAAHLHQHLSKYTASDFSS KDIELIIMAFFDKELLSFQRMTYRHNIHPHFIPDYASSSSTTGWRDNGYVSKQECFPSGMCVIL* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 12,084.980 | ||
Theoretical pI: | 9.504 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 53.259 | ||
aromaticity | 0.037 | ||
GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.269 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334161.1 | complete | 108 | 98-424(+) |
Amino Acid sequence : | |||
MRNQVSCATGKKRVTRRPLRRCTDDTKIGPESLTDLMLKSDLLLMFSISTMERHSTELPITISSDSVGIMQLTYINISPNTLHPILVARTLSSSSWLSLIKNYCLSNA* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,084.980 | ||
Theoretical pI: | 9.504 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 53.259 | ||
aromaticity | 0.037 | ||
GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.269 | ||
sheet | 0.241 |