Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334165.1 | 5prime_partial | 123 | 1-372(+) |
Amino Acid sequence : | |||
QIHTHMCYSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYAEVKPALENMVAAAKLLRTQLA SAK* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 11,172.868 | ||
Theoretical pI: | 9.096 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 59.830 | ||
aromaticity | 0.110 | ||
GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.300 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334165.1 | complete | 100 | 323-21(-) |
Amino Acid sequence : | |||
MFSRAGFTSAYFRVLRPQSGFTHRMLVSRTASILLIRSAISSVDGILGEWMSYTPGPIPAPYFTPSRNTDSSFSSEREFSIVITSASMLMMECMMSLKLE* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,172.868 | ||
Theoretical pI: | 9.096 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 59.830 | ||
aromaticity | 0.110 | ||
GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.300 | ||
sheet | 0.270 |