| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334180.1 | complete | 224 | 34-708(+) |
Amino Acid sequence : | |||
| MDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWD DIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 26,036.415 | ||
| Theoretical pI: | 5.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48360 48485 | ||
| Instability index: | 34.017 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.219 | ||
| sheet | 0.232 | ||