| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334197.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| FWGDTPEDEYYASQGVRNSKSDFETPHGRLFTQSFLPLDPTQAVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSEEYKDL PAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNFDKVKV PFLVLHGTLDGVAEV | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,561.625 | ||
| Theoretical pI: | 6.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
| Instability index: | 26.919 | ||
| aromaticity | 0.137 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.235 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334197.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| FWGDTPEDEYYASQGVRNSKSDFETPHGRLFTQSFLPLDPTQAVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSEEYKDL PAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNFDKVKV PFLVLHGTLDGVAEV | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,561.625 | ||
| Theoretical pI: | 6.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
| Instability index: | 26.919 | ||
| aromaticity | 0.137 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.235 | ||
| sheet | 0.263 | ||