| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334198.1 | 5prime_partial | 227 | 767-84(-) |
Amino Acid sequence : | |||
| IRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNP MRYTGKPRVGTMRELVRQTDYVQRNFDKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENANLVLADMRAWIDTRVERDGSNSSAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 15,779.147 | ||
| Theoretical pI: | 8.911 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 55.615 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334198.1 | complete | 141 | 87-512(+) |
Amino Acid sequence : | |||
| MCTTVGTISLNSSINPSPHISQHKISILIGLTLHQRVIHPFIQFQSLVLAAGLLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIF DGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,779.147 | ||
| Theoretical pI: | 8.911 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 55.615 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334198.1 | 5prime_partial | 227 | 767-84(-) |
Amino Acid sequence : | |||
| IRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNP MRYTGKPRVGTMRELVRQTDYVQRNFDKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENANLVLADMRAWIDTRVERDGSNSSAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 15,779.147 | ||
| Theoretical pI: | 8.911 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 55.615 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334198.1 | complete | 141 | 87-512(+) |
Amino Acid sequence : | |||
| MCTTVGTISLNSSINPSPHISQHKISILIGLTLHQRVIHPFIQFQSLVLAAGLLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIF DGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,779.147 | ||
| Theoretical pI: | 8.911 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 55.615 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.191 | ||