Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334216.1 | complete | 213 | 80-721(+) |
Amino Acid sequence : | |||
MGSNEVESVMVDEIPFPLLISVSKPLSLMGYGITDIEIHFLQIKFTAIGVYLDPEIVTHLQKWKLKSAADLSEDDDFFDALISAPVDKLLRVVVIKEIKGSQYGVQLENAVRDRLAEEDK YEEDEEAALEEVVNFFQSKYFKKDSLLTFYFPTSTPPTAEIAFATEGKEESKMEVKNANVAEMIGKWYLGGTRGVSQSTISSVAAALSAELSK* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 23,671.648 | ||
Theoretical pI: | 4.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 40.171 | ||
aromaticity | 0.094 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.202 | ||
sheet | 0.310 |