| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334216.1 | complete | 213 | 80-721(+) |
Amino Acid sequence : | |||
| MGSNEVESVMVDEIPFPLLISVSKPLSLMGYGITDIEIHFLQIKFTAIGVYLDPEIVTHLQKWKLKSAADLSEDDDFFDALISAPVDKLLRVVVIKEIKGSQYGVQLENAVRDRLAEEDK YEEDEEAALEEVVNFFQSKYFKKDSLLTFYFPTSTPPTAEIAFATEGKEESKMEVKNANVAEMIGKWYLGGTRGVSQSTISSVAAALSAELSK* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,671.648 | ||
| Theoretical pI: | 4.567 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 40.171 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.202 | ||
| sheet | 0.310 | ||