| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334217.1 | internal | 276 | 1-828(+) |
Amino Acid sequence : | |||
| GHVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVNGHPTLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVEL WIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILA DGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFA | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 16,288.810 | ||
| Theoretical pI: | 11.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 61.245 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.129 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334217.1 | 3prime_partial | 139 | 417-1(-) |
Amino Acid sequence : | |||
| MNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTGGGFTVRAGDALVSDAQLRAVHRRRGEVGDAERLRERRRRWRVRLLFDWDYVKRRVTVDDGDAIGALLGVLLLRLHL ASEYRARALPFVTRPAYVT | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 16,288.810 | ||
| Theoretical pI: | 11.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 61.245 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.129 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334217.1 | internal | 276 | 1-828(+) |
Amino Acid sequence : | |||
| GHVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVNGHPTLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVEL WIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILA DGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFA | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 16,288.810 | ||
| Theoretical pI: | 11.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 61.245 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.129 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334217.1 | 3prime_partial | 139 | 417-1(-) |
Amino Acid sequence : | |||
| MNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTGGGFTVRAGDALVSDAQLRAVHRRRGEVGDAERLRERRRRWRVRLLFDWDYVKRRVTVDDGDAIGALLGVLLLRLHL ASEYRARALPFVTRPAYVT | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 16,288.810 | ||
| Theoretical pI: | 11.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 61.245 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.129 | ||
| sheet | 0.281 | ||