| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334222.1 | internal | 269 | 1-807(+) |
Amino Acid sequence : | |||
| FSLYNLSPLRHTLCVKCVSVSMAPAAFWNSSKTVCVMDASGRLGSALVSRLLRRGYTVHAAVHSHDEVYKMQSIEKEELRVFCTDPLDYHSILDALKGCSALFYSFELPSDHPTYDEFMG ELEVRAAHNVLEACAQTDTIDKVVFTSSATAVVWRDGPQDGRASDVDERNWSDVNFCKKFKLWHGLSKTIAEKTAWALAMDRGVNMVSINAGLLMCPDLSIKDPYLLGAAEMFKDGVLVT VDLEFLVDAHICVFEDVSSYGRYLCFHGI | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 29,966.970 | ||
| Theoretical pI: | 5.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41535 | ||
| Instability index: | 28.661 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.197 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334222.1 | internal | 269 | 1-807(+) |
Amino Acid sequence : | |||
| FSLYNLSPLRHTLCVKCVSVSMAPAAFWNSSKTVCVMDASGRLGSALVSRLLRRGYTVHAAVHSHDEVYKMQSIEKEELRVFCTDPLDYHSILDALKGCSALFYSFELPSDHPTYDEFMG ELEVRAAHNVLEACAQTDTIDKVVFTSSATAVVWRDGPQDGRASDVDERNWSDVNFCKKFKLWHGLSKTIAEKTAWALAMDRGVNMVSINAGLLMCPDLSIKDPYLLGAAEMFKDGVLVT VDLEFLVDAHICVFEDVSSYGRYLCFHGI | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 29,966.970 | ||
| Theoretical pI: | 5.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41535 | ||
| Instability index: | 28.661 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.197 | ||
| sheet | 0.275 | ||