Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334227.1 | 5prime_partial | 227 | 3-686(+) |
Amino Acid sequence : | |||
RSPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKY GGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPATRYSMVAMAVLSFLASKWLSHFIHKTFYNHGYDHAFV* | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,906.574 | ||
Theoretical pI: | 9.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51130 | ||
Instability index: | 59.446 | ||
aromaticity | 0.137 | ||
GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.198 | ||
sheet | 0.242 |