| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334233.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
| TTTTHKSGRNTRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQAMSPGFKAYAKQVRANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGN KVEKLCDLCTITVNKNAVFGDSSALAPGGVRI | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,300.562 | ||
| Theoretical pI: | 9.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 45.350 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.276 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334233.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
| TTTTHKSGRNTRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQAMSPGFKAYAKQVRANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGN KVEKLCDLCTITVNKNAVFGDSSALAPGGVRI | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,300.562 | ||
| Theoretical pI: | 9.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 45.350 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.276 | ||
| sheet | 0.237 | ||