Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334238.1	5prime_partial	171	809-294(-)
Amino Acid sequence :
ARRLDLFSTASALRSSPHLDPLYPLRPHKLLSPFSSSSPAPPLLNSAMIDAMGNSNSNLGASTSNNPNSYQLSGEHHLLGVHQNMNLSGFLSRDAGVQVRSNDDDLSRWKSGETVRNNDG IPENMVEFDGNNIHSGESQNYNLNLAQKGMEHNIASTAAQGTVASWICPSE*
Physicochemical properties
Number of amino acids:		171
Molecular weight:		13,431.704
Theoretical pI:		6.730
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29910 30285
Instability index:		66.615
aromaticity		0.191
GRAVY		-0.855
Secondary Structure Fraction
Helix		0.300
turn		0.209
sheet		0.127

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334238.1	complete	110	314-646(+)
Amino Acid sequence :
MKQQYLEQQWKQYYVPFLFVQDSNCNFGIHRCEYYFHQTQPYFPESHHCFSLFLHFSTCSDHHHYSSLARRRRGSGSRSNSYFDVRPTDDAPLTTDNCLDYWRWTHLDCC*
Physicochemical properties
Number of amino acids:		110
Molecular weight:		13,431.704
Theoretical pI:		6.730
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29910 30285
Instability index:		66.615
aromaticity		0.191
GRAVY		-0.855
Secondary Structure Fraction
Helix		0.300
turn		0.209
sheet		0.127