Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334243.1 | 5prime_partial | 194 | 769-185(-) |
Amino Acid sequence : | |||
LQAWWKELREEGHGDKKDEAWWPKMQTCKELIDSLTIIIWIASALHAAVNFGQYPYAGYMPNRPTISRQFMPEPGSEDYEELKTNPDKVFLKIITARLQTLLGIALIEILSRHSSDELYL GQRDTPVWTKDAGPLEAFEEFGRKLAEVERRIAEMNGDKRWKNRVGPVKLPYTLLYPTSEEGMTGKGIPNSVSI* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 17,192.988 | ||
Theoretical pI: | 9.445 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 54.397 | ||
aromaticity | 0.072 | ||
GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.250 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334243.1 | complete | 152 | 179-637(+) |
Amino Acid sequence : | |||
MTSNANTVGNSFACHAFFACRIQQRVGQLHRPNSVLPSLIAIHLCNPPLHLSQLPPKFLKCLKRPCIFSPHWSVPLPEIQLIRRVPRQYLNQGNAKQRLQPGSDDFQEHLIRVGFQLLIV FTAGLRHELPADCGTIRHVPSVWVLPEVHCCV* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,192.988 | ||
Theoretical pI: | 9.445 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 54.397 | ||
aromaticity | 0.072 | ||
GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.250 | ||
sheet | 0.211 |