Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334244.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
RPPTKTDPKSESRIPLLLSLNIYVPRDERFGHLKLSDFLGYGLKSIFQFLLPEFTNLCESISNEFQSFDDAMQIYKGGVKLPDGPLLKNIYDNVPLELLKEILPTDGEGVFKYPMPDIIQ VDKTAWRTDEEFAREMLAGMNPVVISRLQEFPPTSKLDEEVYGNQTSTITW | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,560.145 | ||
Theoretical pI: | 4.721 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 35.453 | ||
aromaticity | 0.105 | ||
GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.251 | ||
sheet | 0.251 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334244.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
RPPTKTDPKSESRIPLLLSLNIYVPRDERFGHLKLSDFLGYGLKSIFQFLLPEFTNLCESISNEFQSFDDAMQIYKGGVKLPDGPLLKNIYDNVPLELLKEILPTDGEGVFKYPMPDIIQ VDKTAWRTDEEFAREMLAGMNPVVISRLQEFPPTSKLDEEVYGNQTSTITW | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,560.145 | ||
Theoretical pI: | 4.721 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 35.453 | ||
aromaticity | 0.105 | ||
GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.251 | ||
sheet | 0.251 |