| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334246.1 | 3prime_partial | 230 | 70-759(+) |
Amino Acid sequence : | |||
| MARKKIREYDSKRLLKEHFKRISGSELEIKSAQVTESTDFNELVEKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAGVAGFVKERLGKEVEMGGCKGPITTFIVEPFVPHNEEFYLN IVSERLGCSISFSECGGIEIEENWDKVKTIFLPTGSSLTSETCAPLVATLPLEIKPVIEEFLKVIYALFLDLDFTFLEMNPFTLVNGKPYPLDMRGELDDTAAFQNFQKW | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 11,709.329 | ||
| Theoretical pI: | 9.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 30.001 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.352 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334246.1 | complete | 108 | 386-60(-) |
Amino Acid sequence : | |||
| MNVVIGPLHPPISTSLPSRSFTKPATPAKSRFKATRPLLPRFPKSISGLTTNLVDESHGSFSTSSLKSVDSVTWADLISNSDPEILLKCSFNNLLESYSLIFFLAISA* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,709.329 | ||
| Theoretical pI: | 9.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 30.001 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.352 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334246.1 | 3prime_partial | 230 | 70-759(+) |
Amino Acid sequence : | |||
| MARKKIREYDSKRLLKEHFKRISGSELEIKSAQVTESTDFNELVEKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAGVAGFVKERLGKEVEMGGCKGPITTFIVEPFVPHNEEFYLN IVSERLGCSISFSECGGIEIEENWDKVKTIFLPTGSSLTSETCAPLVATLPLEIKPVIEEFLKVIYALFLDLDFTFLEMNPFTLVNGKPYPLDMRGELDDTAAFQNFQKW | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 11,709.329 | ||
| Theoretical pI: | 9.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 30.001 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.352 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334246.1 | complete | 108 | 386-60(-) |
Amino Acid sequence : | |||
| MNVVIGPLHPPISTSLPSRSFTKPATPAKSRFKATRPLLPRFPKSISGLTTNLVDESHGSFSTSSLKSVDSVTWADLISNSDPEILLKCSFNNLLESYSLIFFLAISA* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,709.329 | ||
| Theoretical pI: | 9.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 30.001 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.352 | ||
| sheet | 0.222 | ||