| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334250.1 | 5prime_partial | 135 | 1-408(+) |
Amino Acid sequence : | |||
| APREDSRIMSLLWEKSRTWRWLVTRTRDSKPFFFTFATVCGVIPGAIGYFVMQLTSSGNPELEAKLRKSARPESLMMGKVNQERLAEYLGELKRKEDTNDRYVAALRGETLTRKPYVRIQ PVPKPGNDEAKEEKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 12,113.937 | ||
| Theoretical pI: | 9.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 57.964 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.404 | ||
| turn | 0.240 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334250.1 | 5prime_partial | 104 | 630-316(-) |
Amino Acid sequence : | |||
| LLGKKIDNLNYFNYNGVTTANTSKTDLVILSSRRYYHITNQSLNILQQESVESFHPKLNTSSCDHILTKKHFKVLLLFLLGLIVTWLWNWLNPHIRLSRKCLAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,113.937 | ||
| Theoretical pI: | 9.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 57.964 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.404 | ||
| turn | 0.240 | ||
| sheet | 0.221 | ||