Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334250.1 | 5prime_partial | 135 | 1-408(+) |
Amino Acid sequence : | |||
APREDSRIMSLLWEKSRTWRWLVTRTRDSKPFFFTFATVCGVIPGAIGYFVMQLTSSGNPELEAKLRKSARPESLMMGKVNQERLAEYLGELKRKEDTNDRYVAALRGETLTRKPYVRIQ PVPKPGNDEAKEEKK* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 12,113.937 | ||
Theoretical pI: | 9.745 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 57.964 | ||
aromaticity | 0.106 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.240 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334250.1 | 5prime_partial | 104 | 630-316(-) |
Amino Acid sequence : | |||
LLGKKIDNLNYFNYNGVTTANTSKTDLVILSSRRYYHITNQSLNILQQESVESFHPKLNTSSCDHILTKKHFKVLLLFLLGLIVTWLWNWLNPHIRLSRKCLAS* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,113.937 | ||
Theoretical pI: | 9.745 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 57.964 | ||
aromaticity | 0.106 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.240 | ||
sheet | 0.221 |