| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334253.1 | 3prime_partial | 127 | 509-889(+) |
Amino Acid sequence : | |||
| MDASRRTLHRITEKESSSSVAVQSDKNVKRSYIPRRLLIGNEEYVRIGNGNQLVRDPKKRTRVLASEKVRWSLRTARLRLARKRKYCQFFTRFGKCNKDDGKCPYIHDPSKIVVCTKFLT GSCTXVN | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 12,432.356 | ||
| Theoretical pI: | 10.899 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 43.753 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.259 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334253.1 | complete | 112 | 17-355(+) |
Amino Acid sequence : | |||
| MSRKRGAIYTRSRHGYSLKMSKVLGVGGSSLKWSKSIDRNSKKANEDATRAVAAAAEKRKKEEKGAVPIASKTRNHVSRKWVLDVKLRPGIPLCNPGVAFLILQHLERGFFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,432.356 | ||
| Theoretical pI: | 10.899 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 43.753 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.259 | ||
| sheet | 0.241 | ||