Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334253.1 | 3prime_partial | 127 | 509-889(+) |
Amino Acid sequence : | |||
MDASRRTLHRITEKESSSSVAVQSDKNVKRSYIPRRLLIGNEEYVRIGNGNQLVRDPKKRTRVLASEKVRWSLRTARLRLARKRKYCQFFTRFGKCNKDDGKCPYIHDPSKIVVCTKFLT GSCTXVN | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 12,432.356 | ||
Theoretical pI: | 10.899 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 43.753 | ||
aromaticity | 0.063 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.259 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334253.1 | complete | 112 | 17-355(+) |
Amino Acid sequence : | |||
MSRKRGAIYTRSRHGYSLKMSKVLGVGGSSLKWSKSIDRNSKKANEDATRAVAAAAEKRKKEEKGAVPIASKTRNHVSRKWVLDVKLRPGIPLCNPGVAFLILQHLERGFFS* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,432.356 | ||
Theoretical pI: | 10.899 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 43.753 | ||
aromaticity | 0.063 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.259 | ||
sheet | 0.241 |