| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334259.1 | 5prime_partial | 244 | 3-737(+) |
Amino Acid sequence : | |||
| GKLHMAARVIAAIENPQDIIVQSARPYGQRAVLKFAQYTGTNAIAGRHTPGTFTNQLQTSFSEPRLLILTDPRTDHQPIKEAALSSIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLF WILARMVLQMRGVIASGHKWDVMVDLFFYREPEEAKEPEQEEAPALDYADYGSAAIGGDWSSAQIPEAQWAPDLAGAGQPVAGGWSAADSGADGWDAAAAPPPPAAAAVLPTSAPVDVTP GGWE* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 12,433.169 | ||
| Theoretical pI: | 10.290 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 48.645 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.481 | ||
| turn | 0.176 | ||
| sheet | 0.370 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334259.1 | complete | 108 | 424-750(+) |
Amino Acid sequence : | |||
| MSWLICFSIGSLKRLRNLSRRKLQLLIMLIMDLQQLVEIGLVPKSRRPNGLLIWLVQVNQLLVVGVLQIQVLMDGMQLLLHLHQPLLLFCQHLLLLTSLQVAGNEMFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,433.169 | ||
| Theoretical pI: | 10.290 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 48.645 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.481 | ||
| turn | 0.176 | ||
| sheet | 0.370 | ||