Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334264.1 | internal | 280 | 2-841(+) |
Amino Acid sequence : | |||
NRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLI ICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKX ALSPGFQAYAKQVKANAVALGHYLMXQGYSLVTGGTENHL | |||
Physicochemical properties | |||
Number of amino acids: | 280 | ||
Molecular weight: | 11,004.882 | ||
Theoretical pI: | 9.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 32.355 | ||
aromaticity | 0.062 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334264.1 | 5prime_partial | 118 | 3-359(+) |
Amino Acid sequence : | |||
TATTVATSSSTRSRTSLAHVPSRPTASTPPNGASMSSPTAAPQLISPPTRLFSTPTTGSWASIYLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRRWISGRS* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,004.882 | ||
Theoretical pI: | 9.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 32.355 | ||
aromaticity | 0.062 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334264.1 | 5prime_partial | 99 | 841-542(-) |
Amino Acid sequence : | |||
QVIFSSTSDKTVPLXHQIVPKCNGIRLDLLSICLKSRGQGXFQGYSKSTNLMIMRTTLKRREDCKVDLILKVVNCIFGLAFLRRLRTLSVEDHASPWTP* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,004.882 | ||
Theoretical pI: | 9.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 32.355 | ||
aromaticity | 0.062 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334264.1 | internal | 280 | 2-841(+) |
Amino Acid sequence : | |||
NRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLI ICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKX ALSPGFQAYAKQVKANAVALGHYLMXQGYSLVTGGTENHL | |||
Physicochemical properties | |||
Number of amino acids: | 280 | ||
Molecular weight: | 11,004.882 | ||
Theoretical pI: | 9.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 32.355 | ||
aromaticity | 0.062 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334264.1 | 5prime_partial | 118 | 3-359(+) |
Amino Acid sequence : | |||
TATTVATSSSTRSRTSLAHVPSRPTASTPPNGASMSSPTAAPQLISPPTRLFSTPTTGSWASIYLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRRWISGRS* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,004.882 | ||
Theoretical pI: | 9.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 32.355 | ||
aromaticity | 0.062 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334264.1 | 5prime_partial | 99 | 841-542(-) |
Amino Acid sequence : | |||
QVIFSSTSDKTVPLXHQIVPKCNGIRLDLLSICLKSRGQGXFQGYSKSTNLMIMRTTLKRREDCKVDLILKVVNCIFGLAFLRRLRTLSVEDHASPWTP* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,004.882 | ||
Theoretical pI: | 9.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 32.355 | ||
aromaticity | 0.062 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.196 |