| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334266.1 | internal | 282 | 2-847(+) |
Amino Acid sequence : | |||
| QHARSVLHLLMEDLDGVRLSSAAAGAFVVADLGCSSGRNAINTMEFMINHLTEHYTVAAEEPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGLAGSFYRRLFPAKSVDFFYSAF SLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKESTVNAYKKQFQSDLGAFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKGDTFNIPIYTPSLE EFKEVVERDGAFIINKLQLFHGGSALIIDDPKRCGEISRAYV | |||
Physicochemical properties | |||
| Number of amino acids: | 282 | ||
| Molecular weight: | 31,181.781 | ||
| Theoretical pI: | 5.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 44.561 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.262 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334266.1 | internal | 282 | 2-847(+) |
Amino Acid sequence : | |||
| QHARSVLHLLMEDLDGVRLSSAAAGAFVVADLGCSSGRNAINTMEFMINHLTEHYTVAAEEPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGLAGSFYRRLFPAKSVDFFYSAF SLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKESTVNAYKKQFQSDLGAFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKGDTFNIPIYTPSLE EFKEVVERDGAFIINKLQLFHGGSALIIDDPKRCGEISRAYV | |||
Physicochemical properties | |||
| Number of amino acids: | 282 | ||
| Molecular weight: | 31,181.781 | ||
| Theoretical pI: | 5.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 44.561 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.262 | ||
| sheet | 0.273 | ||