Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334269.1 | 5prime_partial | 225 | 2-679(+) |
Amino Acid sequence : | |||
SPHARTHAHTRERDMEDEEHEVYGGEIPEMEADADVDMTGAGDDAATKELDEMKKRLKEMEEEAAALREMQAKVEREMGSVQDPASAAASQENKEEVDARSVFVGNVDYACTPEEVQQHF QACGTVNRVTILTDKFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVMVKRTNVPGMKQYRPRRFNPYIAYGSYQRPYMYSPYGYGKMPRARGRSRYMPYY* | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 13,539.075 | ||
Theoretical pI: | 9.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 62.951 | ||
aromaticity | 0.084 | ||
GRAVY | 0.725 | ||
Secondary Structure Fraction | |||
Helix | 0.445 | ||
turn | 0.202 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334269.1 | 3prime_partial | 122 | 368-3(-) |
Amino Acid sequence : | |||
MLENAAVLPRECKHNPHCQQRQILHPPPPCFPEMQQHLQGLEQNPSPFQLWPAFHEAPQLPPPSPSIASSSHPIPWWQRHHQLPSCRRRHRLPSLGSLLRRPHAPRPPYLSLSCVRVCVR AE | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,539.075 | ||
Theoretical pI: | 9.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 62.951 | ||
aromaticity | 0.084 | ||
GRAVY | 0.725 | ||
Secondary Structure Fraction | |||
Helix | 0.445 | ||
turn | 0.202 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334269.1 | 3prime_partial | 119 | 358-2(-) |
Amino Acid sequence : | |||
MLLYFLGSASIIHIANKDRSCIHLLLVFLRCSSTCRVLNRTHLPFNFGLHFTKRRSFLLHLLQSLLHLIQFLGGSVITSSRHVDVGIGFHLWDLSSVDLMLLVLHISLSRVCVCACVRR | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,539.075 | ||
Theoretical pI: | 9.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 62.951 | ||
aromaticity | 0.084 | ||
GRAVY | 0.725 | ||
Secondary Structure Fraction | |||
Helix | 0.445 | ||
turn | 0.202 | ||
sheet | 0.252 |