Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334276.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTTPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPVKYLDDKTIF HLNPSGRFVIGGPHGDAGLTCRKIIIDTY | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 12,724.937 | ||
Theoretical pI: | 7.588 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 38.880 | ||
aromaticity | 0.051 | ||
GRAVY | 0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.212 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334276.1 | complete | 118 | 457-101(-) |
Amino Acid sequence : | |||
MSKGHKLWCFISSIAKHVTLITSSDLLRLLGEMTVNTLSNVGALLLDVNKDLAVVGVKANIRCGEPNASACITNNFLVVHLSLGCDLTKDHDHVCLCACLACYFALWILLQTGIKNGI* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,724.937 | ||
Theoretical pI: | 7.588 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 38.880 | ||
aromaticity | 0.051 | ||
GRAVY | 0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.212 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334276.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTTPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPVKYLDDKTIF HLNPSGRFVIGGPHGDAGLTCRKIIIDTY | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 12,724.937 | ||
Theoretical pI: | 7.588 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 38.880 | ||
aromaticity | 0.051 | ||
GRAVY | 0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.212 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334276.1 | complete | 118 | 457-101(-) |
Amino Acid sequence : | |||
MSKGHKLWCFISSIAKHVTLITSSDLLRLLGEMTVNTLSNVGALLLDVNKDLAVVGVKANIRCGEPNASACITNNFLVVHLSLGCDLTKDHDHVCLCACLACYFALWILLQTGIKNGI* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,724.937 | ||
Theoretical pI: | 7.588 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 38.880 | ||
aromaticity | 0.051 | ||
GRAVY | 0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.212 | ||
sheet | 0.280 |