| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334286.1 | 5prime_partial | 184 | 820-266(-) |
Amino Acid sequence : | |||
| KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 13,956.448 | ||
| Theoretical pI: | 4.698 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 38.123 | ||
| aromaticity | 0.086 | ||
| GRAVY | -1.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.164 | ||
| turn | 0.305 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334286.1 | complete | 155 | 302-769(+) |
Amino Acid sequence : | |||
| MQSRLLLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDRLAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 13,956.448 | ||
| Theoretical pI: | 4.698 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 38.123 | ||
| aromaticity | 0.086 | ||
| GRAVY | -1.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.164 | ||
| turn | 0.305 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334286.1 | 5prime_partial | 128 | 821-435(-) |
Amino Acid sequence : | |||
| KAAGGWQNPGRLQHPEGINSAFGSEASWRDADLRQNSDRQDDHAGSGELGYNRQREGKDTGQGRNPTGSAEADLRWQTAGRWEDSGGLQYPEGVDLASGAEAAWWNADLREDADWKDDHF GGGELGHH* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,956.448 | ||
| Theoretical pI: | 4.698 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 38.123 | ||
| aromaticity | 0.086 | ||
| GRAVY | -1.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.164 | ||
| turn | 0.305 | ||
| sheet | 0.258 | ||