| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334291.1 | 5prime_partial | 150 | 826-374(-) |
Amino Acid sequence : | |||
| NFGNSGGTTNKDNIVDGALVHLGISQALLNRFHTLPEQVHVELLESSTSDGGVKINTLVQRINLNCGLGSGRERSLCPLTSCPQPSQGPGVASDVFLVLPLKFLNKVVDHSVVKIFTTKV SVTSCCLHFKDTLLNREQGDIKRTTSKIKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 12,755.690 | ||
| Theoretical pI: | 9.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 56.055 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.553 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.145 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334291.1 | complete | 111 | 42-377(+) |
Amino Acid sequence : | |||
| MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPLLMVLTRKQPVLERRTF* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,755.690 | ||
| Theoretical pI: | 9.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 56.055 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.553 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.145 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334291.1 | 3prime_partial | 110 | 497-826(+) |
Amino Acid sequence : | |||
| MVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYAPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKV | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,755.690 | ||
| Theoretical pI: | 9.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 56.055 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.553 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.145 | ||
| sheet | 0.245 | ||