| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334298.1 | complete | 211 | 50-685(+) |
Amino Acid sequence : | |||
| MEVGNSSSKVIPESVMEAVKRTSTNIDEVKANLDELLSYCDAETLSELEPLERARALLLIAKTTTTLFALRLRCKGVDSDEHPVKKELERLSLYEEKLQRCIDLNKAPLRPSATINPQAA ARFIEHSLPDLSSEQKQSMRELSRGEGHGFKYLNSNIQKKRKYQSSEKQSVRSAAQEFLEKAARELLGDNKNGVKGPLQPEDSDDDVVIMD* | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 10,792.259 | ||
| Theoretical pI: | 9.691 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
| Instability index: | 44.737 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.320 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334298.1 | complete | 100 | 465-163(-) |
Amino Acid sequence : | |||
| MLCFCSDERSGRECSINRAAACGLIVAEGRNGALFKSMHRCNFSSYKLNLSNSFFTGCSSESTPLHLSLKAKRVVVVLAINKRARALSRGSNSESVSASQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,792.259 | ||
| Theoretical pI: | 9.691 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
| Instability index: | 44.737 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.320 | ||
| sheet | 0.270 | ||