| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334308.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
| LLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGVEFGSRPRNVVF DIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDF IPLLXPFLKGYLAKCRDLQSRKLAF | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 17,018.433 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.472 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.172 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334308.1 | 5prime_partial | 152 | 796-338(-) |
Amino Acid sequence : | |||
| KCELSALQVSAFSKVALQERXEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEGH YAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,018.433 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.472 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.172 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334308.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
| LLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGVEFGSRPRNVVF DIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDF IPLLXPFLKGYLAKCRDLQSRKLAF | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 17,018.433 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.472 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.172 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334308.1 | 5prime_partial | 152 | 796-338(-) |
Amino Acid sequence : | |||
| KCELSALQVSAFSKVALQERXEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEGH YAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,018.433 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.472 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.172 | ||
| sheet | 0.298 | ||