Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334312.1 | 3prime_partial | 241 | 42-764(+) |
Amino Acid sequence : | |||
MTSFKVARVQTSPFDGQKPGTSGLRKKVKVFLQPQYLQNFVQSTFNALGADKVKGATLVVSGDGRYYSKDAIQIIIKMAAANGARRIWVGQNGLLSTPAVSAVIRERVGPDGSKANGAFI LTASHNPGGPDEDFGIKYNMENGGPAPEGITDKIYSNTTTIKEYLIAEGLPDVDISKIGVTGFAGPEGQFDVDVFDSASDYVKLMKTIFDFQSIQKLLSSPKFTFCYDALHGVGGAYAKR M | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 13,963.544 | ||
Theoretical pI: | 9.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 45.256 | ||
aromaticity | 0.067 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.151 | ||
sheet | 0.370 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334312.1 | complete | 119 | 178-537(+) |
Amino Acid sequence : | |||
MPLELIKSKVLLLLYLVMAVTIRRMLSKSSLKWLLQMEQDVSGLARMGCYLHQLYLLLYVKEWALMDPRQMGHLYSQQATTQEALMRILESNTTWKMVDQHQKESLIRSILTPPQLRST* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,963.544 | ||
Theoretical pI: | 9.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 45.256 | ||
aromaticity | 0.067 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.151 | ||
sheet | 0.370 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334312.1 | 3prime_partial | 241 | 42-764(+) |
Amino Acid sequence : | |||
MTSFKVARVQTSPFDGQKPGTSGLRKKVKVFLQPQYLQNFVQSTFNALGADKVKGATLVVSGDGRYYSKDAIQIIIKMAAANGARRIWVGQNGLLSTPAVSAVIRERVGPDGSKANGAFI LTASHNPGGPDEDFGIKYNMENGGPAPEGITDKIYSNTTTIKEYLIAEGLPDVDISKIGVTGFAGPEGQFDVDVFDSASDYVKLMKTIFDFQSIQKLLSSPKFTFCYDALHGVGGAYAKR M | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 13,963.544 | ||
Theoretical pI: | 9.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 45.256 | ||
aromaticity | 0.067 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.151 | ||
sheet | 0.370 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334312.1 | complete | 119 | 178-537(+) |
Amino Acid sequence : | |||
MPLELIKSKVLLLLYLVMAVTIRRMLSKSSLKWLLQMEQDVSGLARMGCYLHQLYLLLYVKEWALMDPRQMGHLYSQQATTQEALMRILESNTTWKMVDQHQKESLIRSILTPPQLRST* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,963.544 | ||
Theoretical pI: | 9.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 45.256 | ||
aromaticity | 0.067 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.151 | ||
sheet | 0.370 |