Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334314.1 | 5prime_partial | 206 | 1-621(+) |
Amino Acid sequence : | |||
IGSKRASWRILSSIEQKEESRGNEQNAKRIKDYRQKVEAELTDICNDIMAVIDEHLIPSCSAGESTVFYYKMKGDYYRYLAEFKTGNDRKDVADQSLKAYELATTTAESELPPTHPIRLG LALNFSVFYYEILNSPERACHLAKQAFDEAISEIDTVNEESYKDSTLILQLLRDNLTLWTSDIPEDADEAKLDAAGKAGGDGSVAQ* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 23,112.450 | ||
Theoretical pI: | 4.713 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 50.335 | ||
aromaticity | 0.083 | ||
GRAVY | -0.550 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.199 | ||
sheet | 0.301 |