Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334320.1 | 5prime_partial | 234 | 3-707(+) |
Amino Acid sequence : | |||
RSLLYIHEQAENAELIHDQDKIATGSETLPLKWAHPISAPENGSLLVATGKLDGVRTFERTVVLLLRSGTRNPQEGPFGIVLNRPLNKQMKHMNPTNAELATTFADCSLYFGGPLDASMF LLRDTENRGLAAFEEVIPGVHFGSRNSLNDAAALVKNGTIRPQELRFFMGYAGWQMDQLIEEIESEYWYVAACSTNLIFGSSHITTLSNGLWEEILQLMGGHYSELSRKPKQDI* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 14,356.729 | ||
Theoretical pI: | 10.556 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 55.696 | ||
aromaticity | 0.097 | ||
GRAVY | 0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.336 | ||
sheet | 0.216 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334320.1 | complete | 134 | 508-104(-) |
Amino Acid sequence : | |||
MKNLSSCGLIVPFFTSAAASFKLFLEPKCTPGITSSKAASPRFSVSLNRNMLASSGPPKYKEQSAKVVANSAFVGFMCFICLLSGRFKTIPNGPSCGFLVPDLRRRTTVLSKVRTPSSFP VATRRLPFSGAEIG* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,356.729 | ||
Theoretical pI: | 10.556 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 55.696 | ||
aromaticity | 0.097 | ||
GRAVY | 0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.336 | ||
sheet | 0.216 |