| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334326.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| AVEDSGDFYALPEDCIATALSLTSPKDACRLSAVAATFRSASQSDAVWARFLPPDYRDLISRAVDGTDLLAKFHLKDLYLHLCDHPILIDGGRKSFQLEKLSGKKCFMLAARDLDIVWGD TPQYWRWTNYPESRFPEVAELVDVCWFEIRGRINMSMLSPGTNYAAYIVFTTKTRLYGFDHQPVDGYVGVSGRDAEKRIICLDPEGAQRQRYQIVPRRVGWFFHRLAHMQRYEEMFPEXG TEY | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 27,793.285 | ||
| Theoretical pI: | 5.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
| Instability index: | 41.464 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.186 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334326.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| AVEDSGDFYALPEDCIATALSLTSPKDACRLSAVAATFRSASQSDAVWARFLPPDYRDLISRAVDGTDLLAKFHLKDLYLHLCDHPILIDGGRKSFQLEKLSGKKCFMLAARDLDIVWGD TPQYWRWTNYPESRFPEVAELVDVCWFEIRGRINMSMLSPGTNYAAYIVFTTKTRLYGFDHQPVDGYVGVSGRDAEKRIICLDPEGAQRQRYQIVPRRVGWFFHRLAHMQRYEEMFPEXG TEY | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 27,793.285 | ||
| Theoretical pI: | 5.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
| Instability index: | 41.464 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.186 | ||
| sheet | 0.252 | ||