| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334333.1 | 5prime_partial | 230 | 2-694(+) |
Amino Acid sequence : | |||
| QFRSLAYKNHQINVPMNVTTNLLFTISVNIRACPNSDCAGPGGNRLISSINNITFQQPRISILQAYYEMINGVYGDDFPSQPPFPFNYTADVVPQIFWTSSNGTRVRVLDYNATVELVFQ GTNIVAPSEHPMHLHGHNFYVVGSGFGNFNRARDAPNYNLVDPPFRNTIAVPRSGWTAIRFRANNPGVWLLHCHFERHITWGMEMAFITRNGRGPNATMLPPPSDFPMCS* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 15,513.941 | ||
| Theoretical pI: | 8.790 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 61.803 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.158 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334333.1 | 3prime_partial | 133 | 400-2(-) |
Amino Acid sequence : | |||
| MHRVFAWCHYVCPLKNELHCRIIVKNPHPRPVTRCPKDLRHNICCVIEWKRRLAREIVAIDAIDHLIISLENRDSRLLKRDIVDARDQPIPARPSAVGIRASPDVDRDSEEQIRCHIHRH VNLMVFVGEAAEL | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,513.941 | ||
| Theoretical pI: | 8.790 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 61.803 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.158 | ||
| sheet | 0.226 | ||